Product information
| Sequence (One Letter Code) |
ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (all D amino acid) |
| Sequence (Three Letter Code) |
D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly |
| Formula |
C228H388N86O64 |
| Molecular Weight |
5358.05 |
| Form |
Lyophilized powder |
| Purity |
> 95% |
| Storage |
Shipped at 4℃. Stored at -20℃ for one year. |
| Note |
For research use only. |
FOXO4-DRI’s potential applications
While still primarily used within research contexts, potential applications for FOXO4-DRI could include skin rejuvenation by reducing the accumulation of age-related senescent cells. This mechanism could improve skin texture and elasticity, hallmarks of youthful skin.
Safety and efficacy
As with any emerging therapy, understanding the safety profile of FOXO4-DRI is paramount. Thus far, preclinical trials suggest it has promising potential with low toxicity, although further studies are essential before it becomes widely available for therapeutic use.
The relationship between FOXO4-DRI and skincare
In skincare and cosmetics, ingredients that support healthy cell turnover are prized for their ability to maintain skin vitality. With its ability to target only senescent cells while preserving healthy ones, FOXO4-DRI may become a powerful agent within advanced skincare routines.
For more information about the revolutionary impact of peptides like FOXO4-DRI on medical aesthetics or to explore the world of biohacking for longevity, visit authoritative resources such as NCBI or other peer-reviewed scientific journals.